SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1447_internal:A_BomoASG_c9090_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		helicase_POLQ-like_isoform_X4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000724 P double-strand break repair via homologous recombination
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003887 F DNA-directed DNA polymerase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006260 P DNA replication
GO:0006261 P DNA-dependent DNA replication
GO:0006281 P DNA repair
GO:0006284 P base-excision repair
GO:0006302 P double-strand break repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0016446 P somatic hypermutation of immunoglobulin genes
GO:0016740 F transferase activity
GO:0016779 F nucleotidyltransferase activity
GO:0043142 F single-stranded DNA helicase activity
GO:0051260 P protein homooligomerization
GO:0051575 F 5'-deoxyribose-5-phosphate lyase activity
GO:0071897 P DNA biosynthetic process
GO:0097681 P double-strand break repair via alternative nonhomologous end joining
GO:2000042 P negative regulation of double-strand break repair via homologous recombination
RNA-seq EntryA_BomoASG_c9090_g1_i1
Sequence
(Amino Acid)
AARRLVAELRRAARGLVLCGPLHLLYLAAPHDDPVRPDPRHFYSLYCELDEEGLQTAKAL
GINETNAIRMMTGRPMASVPSLVVSRFYMALMLRDLWRHMPLHAVADKYLVG
(36 a.a.)

- SilkBase 1999-2023 -