SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG14391_complete:A_BomoASG_c28621_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		protein_hairy_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000902 P cell morphogenesis
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001666 P response to hypoxia
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007366 P periodic partitioning by pair rule gene
GO:0007399 P nervous system development
GO:0007424 P open tracheal system development
GO:0007431 P salivary gland development
GO:0007435 P salivary gland morphogenesis
GO:0007460 P R8 cell fate commitment
GO:0008134 F transcription factor binding
GO:0008407 P chaeta morphogenesis
GO:0031323 P regulation of cellular metabolic process
GO:0035239 P tube morphogenesis
GO:0035289 P posterior head segmentation
GO:0035290 P trunk segmentation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046983 F protein dimerization activity
GO:0061024 P membrane organization
GO:0070888 F E-box binding
RNA-seq EntryA_BomoASG_c28621_g1_i1
Sequence
(Amino Acid)
MVTGIAGSPQQGVSNPVVVMNAVNNSGQNDQKKSSDNRRSNKPIMEKRRRARINNCLNEL
KALILDAMKKDPARHSKLEKADILEMTVKHLEGLRSEGAVSPDKFRAGYRQCVTEVAKFQ
GMEPALRRRLVRHLETCVNSTSGTRPASAPTPPSDTDDPGNQHSTIFIAAGPGSGVRLLP
TRLSNGDIALVLPAGVTTSAIGGLPNLVPLSPRDASSSTSEQRCYSPESSGWGTPPPSSE
DAAPLALVTRKQPEEKPWRPW
*(86 a.a.)

- SilkBase 1999-2023 -