SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG14317_3prime_partial:A_BomoASG_c28594_g2_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
serine/threonine-protein_kinase/endoribonuclease_IRE1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0001935 P endothelial cell proliferation
GO:0003824 F catalytic activity
GO:0004519 F endonuclease activity
GO:0004521 F endoribonuclease activity
GO:0004540 F ribonuclease activity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005637 C nuclear inner membrane
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006379 P mRNA cleavage
GO:0006397 P mRNA processing
GO:0006402 P mRNA catabolic process
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006986 P response to unfolded protein
GO:0006987 P obsolete activation of signaling protein activity involved in unfolded protein response
GO:0007050 P regulation of cell cycle
GO:0007257 P obsolete activation of JUN kinase activity
GO:0008152 P metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016241 P regulation of macroautophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0016787 F hydrolase activity
GO:0019899 F enzyme binding
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030544 F Hsp70 protein binding
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0033120 P positive regulation of RNA splicing
GO:0034976 P response to endoplasmic reticulum stress
GO:0035924 P cellular response to vascular endothelial growth factor stimulus
GO:0036289 P peptidyl-serine autophosphorylation
GO:0036498 P IRE1-mediated unfolded protein response
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043531 F ADP binding
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0051879 F Hsp90 protein binding
GO:0070054 P mRNA splicing, via endonucleolytic cleavage and ligation
GO:0070055 P obsolete mRNA endonucleolytic cleavage involved in unfolded protein response
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0071333 P cellular response to glucose stimulus
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
GO:1900103 P positive regulation of endoplasmic reticulum unfolded protein response
GO:1901142 P insulin metabolic process
GO:1990332 C Ire1 complex
GO:1990579 P peptidyl-serine trans-autophosphorylation
GO:1990597 C AIP1-IRE1 complex
GO:1990604 C IRE1-TRAF2-ASK1 complex
GO:1990630 C IRE1-RACK1-PP2A complex
RNA-seq EntryA_BomoASG_c28594_g2_i1
Sequence
(Amino Acid)
MKFLLLILFLLGSSGFGTVVDEEGKESTEISRALDDRPLLFATLGGGMVAVDPVSGDIIW
KLKDEPVVKVPSQDANLMPQFLPDPRHGFLYTYGPRGDQQMLKKLPFTIPELVANAPCRS
TDGILYTGKKSDTWFMIDPLTGFREHVSGFDKSKIFKSDDENTCNSEKKKGIYVARTEYN
ILMHDSKNVNHKWNVTFFDYTSLAMGKDMLNDYGTIHFTSTSN
(73 a.a.)

- SilkBase 1999-2023 -