SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG14233_complete:A_BomoASG_c28563_g1_i2
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		N-glycosylase/DNA_lyase_[Bombyx_mori]
Ontology
GO:0000702 F oxidized base lesion DNA N-glycosylase activity
GO:0002526 P acute inflammatory response
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0003824 F catalytic activity
GO:0003906 F DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005739 C mitochondrion
GO:0006281 P DNA repair
GO:0006284 P base-excision repair
GO:0006289 P nucleotide-excision repair
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0006979 P response to oxidative stress
GO:0007568 P aging
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0008534 F oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0009314 P response to radiation
GO:0009416 P response to light stimulus
GO:0016363 C nuclear matrix
GO:0016607 C nuclear speck
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0016829 F lyase activity
GO:0019104 F DNA N-glycosylase activity
GO:0032355 P response to estradiol
GO:0032357 F oxidized purine DNA binding
GO:0033158 P obsolete regulation of protein import into nucleus, translocation
GO:0033683 P nucleotide-excision repair, DNA incision
GO:0034039 F 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0042493 P response to xenobiotic stimulus
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0045471 P response to ethanol
GO:0051593 P response to folic acid
GO:0071276 P cellular response to cadmium ion
GO:1901291 P negative regulation of double-strand break repair via single-strand annealing
RNA-seq EntryA_BomoASG_c28563_g1_i2
Sequence
(Amino Acid)
MSWKKLNCQPHDLQLLATLSGGQSFRWTHNTETDEWTGIFSKTIWKLKQGDNCLLYQVLG
SLLNFPENNGSNNKKTNFKKLLENYLRLDYDLKELYKDWSNKDELFKSAGQQFYGVRMLR
QEPVENLFSFICSQNNHISRISSMVEKLCTNYGEEIC
*(51 a.a.)

- SilkBase 1999-2023 -