SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG14128_5prime_partial:A_BomoASG_c28518_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
splicing_factor_1_[Bombyx_mori]
Ontology
GO:0000245 P spliceosomal complex assembly
GO:0000389 P mRNA 3'-splice site recognition
GO:0000398 P mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003714 F transcription corepressor activity
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005681 C spliceosomal complex
GO:0005840 C ribosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0008270 F zinc ion binding
GO:0008380 P RNA splicing
GO:0030238 P male sex determination
GO:0033327 P Leydig cell differentiation
GO:0042802 F identical protein binding
GO:0044822 F RNA binding
GO:0046872 F metal ion binding
GO:0048662 P negative regulation of smooth muscle cell proliferation
GO:0050810 P regulation of steroid biosynthetic process
GO:1903507 P negative regulation of nucleic acid-templated transcription
RNA-seq EntryA_BomoASG_c28518_g1_i1
Sequence
(Amino Acid)
AAALSAAAAVPPPTSVQQKLELLQAKHRDRDHHPDDDKDDGLGPPGETAAERRARRRRTR
WTGSEHDKTFIPGLPTVLPSTLTKDQEEQYLLQLQIEEVSRKLRSGDLGIPANVEERYS
*(39 a.a.)

- SilkBase 1999-2023 -