SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG14108_5prime_partial:A_BomoASG_c28508_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
serine/threonine-protein_kinase_Warts_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0000819 P sister chromatid segregation
GO:0000922 C spindle pole
GO:0001827 P inner cell mass cell fate commitment
GO:0001828 P inner cell mass cellular morphogenesis
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0009755 P hormone-mediated signaling pathway
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0019901 F protein kinase binding
GO:0030216 P keratinocyte differentiation
GO:0030833 P regulation of actin filament polymerization
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0034613 P cellular protein localization
GO:0035329 P hippo signaling
GO:0043065 P positive regulation of apoptotic process
GO:0043254 P regulation of protein-containing complex assembly
GO:0045736 P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0046620 P regulation of organ growth
GO:0046872 F metal ion binding
GO:0051220 P cytoplasmic sequestering of protein
GO:0051301 P cell division
GO:0090090 P negative regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomoASG_c28508_g1_i1
Sequence
(Amino Acid)
RSEERIPGGDLMSLLIKLGIFEENLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRD
GHIKLTDFGLCTGFRWTHNSKYYQRNDHGRQDSMDPVDGEWGAMGECRCYQLKPLERRRR
REHQRCLAHSLVGTPNYIAPEVLQRTGYTQLCDWWSVGVILYEMLVGSPPFLAPTPAETQ
LKVINWESTLHVPDAANLSPESKDLILQLCSGQDTRLGKDANEVKNHPFLKGIDFDKGLR
NQVAPYIPRIEYPTDTSNFDPIDPDKLRNSGSSDSNKSDSELLDNGKTFHGFFEFTFRRF
FDDGYTSKINLDDNDNQGPVYV
*(106 a.a.)

- SilkBase 1999-2023 -