SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG14073_internal:A_BomoASG_c28493_g1_i1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101738884_[Bombyx_mori]
Ontology
GO:0000183 P rDNA heterochromatin assembly
GO:0001164 F RNA polymerase I core promoter sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005677 C chromatin silencing complex
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006306 P DNA methylation
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008270 F zinc ion binding
GO:0016479 P negative regulation of transcription by RNA polymerase I
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0033553 C rDNA heterochromatin
GO:0034770 P histone H4-K20 methylation
GO:0042393 F histone binding
GO:0046872 F metal ion binding
GO:0051567 P histone H3-K9 methylation
GO:0070577 F lysine-acetylated histone binding
GO:0070869 P heterochromatin assembly
GO:0070933 P histone H4 deacetylation
RNA-seq EntryA_BomoASG_c28493_g1_i1
Sequence
(Amino Acid)
ENDEEFKGFDTFEDIKTEVYGRVVARLEAEVSAAIKNFTPVRNVIATPTASKRPRTDTDG
SRPSSAMSSKSDENTDRRRATIDMSSPALRLPLERGWKRELVYRAALDSHSRKHGDIYYY
TPLGKKLRSTREVSE
(44 a.a.)

- SilkBase 1999-2023 -