SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG14012_3prime_partial:A_BomoASG_c28471_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
lethal(2)_giant_larvae_protein_isoform_X3_[Bombyx_mori]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0000149 F SNARE binding
GO:0001738 P morphogenesis of a polarized epithelium
GO:0002009 P morphogenesis of an epithelium
GO:0004860 F protein kinase inhibitor activity
GO:0005096 F GTPase activator activity
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005614 C interstitial matrix
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005918 C septate junction
GO:0005920 C smooth septate junction
GO:0005938 C cell cortex
GO:0006469 P negative regulation of protein kinase activity
GO:0006887 P exocytosis
GO:0007049 P cell cycle
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007269 P neurotransmitter secretion
GO:0007275 P multicellular organism development
GO:0007293 P germarium-derived egg chamber formation
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007391 P dorsal closure
GO:0007399 P nervous system development
GO:0007406 P negative regulation of neuroblast proliferation
GO:0007423 P sensory organ development
GO:0008021 C synaptic vesicle
GO:0008104 P protein localization
GO:0008105 P protein localization
GO:0008283 P cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0008360 P regulation of cell shape
GO:0016020 C membrane
GO:0016082 P synaptic vesicle priming
GO:0016323 C basolateral plasma membrane
GO:0016325 P oocyte microtubule cytoskeleton organization
GO:0016327 C apicolateral plasma membrane
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0016333 P morphogenesis of follicular epithelium
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0016335 P morphogenesis of larval imaginal disc epithelium
GO:0016336 P establishment or maintenance of polarity of larval imaginal disc epithelium
GO:0017022 F myosin binding
GO:0017137 F small GTPase binding
GO:0017157 P regulation of exocytosis
GO:0019905 F syntaxin binding
GO:0019991 P septate junction assembly
GO:0030036 P actin cytoskeleton organization
GO:0030154 P cell differentiation
GO:0030863 C cortical cytoskeleton
GO:0030864 C cortical actin cytoskeleton
GO:0030866 P cortical actin cytoskeleton organization
GO:0032878 P regulation of establishment or maintenance of cell polarity
GO:0035070 P salivary gland histolysis
GO:0035072 P ecdysone-mediated induction of salivary gland cell autophagic cell death
GO:0035212 P cell competition in a multicellular organism
GO:0035293 P chitin-based larval cuticle pattern formation
GO:0042127 P regulation of cell population proliferation
GO:0043547 P positive regulation of GTPase activity
GO:0045159 F myosin II binding
GO:0045167 P asymmetric protein localization involved in cell fate determination
GO:0045175 P basal protein localization
GO:0045176 P apical protein localization
GO:0045184 P establishment of protein localization
GO:0045196 P establishment or maintenance of neuroblast polarity
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045200 P establishment of neuroblast polarity
GO:0045746 P negative regulation of Notch signaling pathway
GO:0048730 P epidermis morphogenesis
GO:0050708 P regulation of protein secretion
GO:0051668 P localization within membrane
GO:0051726 P regulation of cell cycle
GO:0055059 P asymmetric neuroblast division
GO:0060429 P epithelium development
GO:0072697 P protein localization to cell cortex
GO:0090163 P establishment of epithelial cell planar polarity
GO:0098725 P symmetric cell division
RNA-seq EntryA_BomoASG_c28471_g1_i1
Sequence
(Amino Acid)
MLKFIRGKGQQPSAERQKLQNELFAFRKTVQHGFPHRASALAWDPLLRLAALGTATGALK
VYGRPGVELYGQHTNYESIVTQIHFITGTGRLISLCDDNSLHLWEINEKSLVELKSHVFE
GKNKKISAICVESSAKNALLGTEGGNIYSLDLSAFTISEDVIYQDVVMQNCPEDYKVNPG
AVESVYEHPKTPTRILIGYNRGLAVLWDREAAAPTHTFVSNQQLESLCWNDDGEHFTSSH
NDGSYVTWEVAGASSDRPLKEPVTPYGPYPCKAITKILNRTSVDGEDITIFAGGMPRASY
SDKYTVTVQQGEKHVAFDFTSRVIDLFTTTPVPPDGAPLQEEQPDTPALVQV
(116 a.a.)

- SilkBase 1999-2023 -