SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1398_complete:A_BomoASG_c8616_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		ubiquitin-conjugating_enzyme_E2-17_kDa_[Papilio_polytes]
Ontology
GO:0000166 F nucleotide binding
GO:0000209 P protein polyubiquitination
GO:0001745 P compound eye morphogenesis
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005875 C microtubule associated complex
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007140 P male meiotic nuclear division
GO:0007286 P spermatid development
GO:0008054 P anaphase-promoting complex-dependent catabolic process
GO:0016322 P neuron remodeling
GO:0016567 P protein ubiquitination
GO:0016740 F transferase activity
GO:0022008 P neurogenesis
GO:0030718 P germ-line stem cell population maintenance
GO:0031625 F ubiquitin protein ligase binding
GO:0031647 P regulation of protein stability
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0045676 P regulation of R7 cell differentiation
GO:0048132 P female germ-line stem cell asymmetric division
GO:0048477 P oogenesis
GO:0051276 P chromosome organization
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0061630 F ubiquitin protein ligase activity
GO:0061631 F ubiquitin conjugating enzyme activity
RNA-seq EntryA_BomoASG_c8616_g1_i1
Sequence
(Amino Acid)
MALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDREKYNELAREWTRKYAM
*(48 a.a.)

- SilkBase 1999-2023 -