SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1392_internal:A_BomoASG_c8561_g1_i1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
DNA_polymerase_epsilon_catalytic_subunit_A_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000731 P DNA synthesis involved in DNA repair
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003887 F DNA-directed DNA polymerase activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005886 C plasma membrane
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006287 P base-excision repair, gap-filling
GO:0006297 P nucleotide-excision repair, DNA gap filling
GO:0006974 P cellular response to DNA damage stimulus
GO:0008270 F zinc ion binding
GO:0008408 F 3'-5' exonuclease activity
GO:0008622 C epsilon DNA polymerase complex
GO:0016740 F transferase activity
GO:0016779 F nucleotidyltransferase activity
GO:0046872 F metal ion binding
GO:0048568 P embryonic organ development
GO:0051536 F iron-sulfur cluster binding
GO:0051539 F 4 iron, 4 sulfur cluster binding
GO:0071897 P DNA biosynthetic process
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
RNA-seq EntryA_BomoASG_c8561_g1_i1
Sequence
(Amino Acid)
DLTERAGPALLAVQAALSLPALTALMPGLVDYPIVPLHVRDVETLYNTLEWQRIGARAIV
RHYLNLESVLALTIEQCRYFHVPLGNMPADPTLFGADLFYARHLVKHNFVLWCSNLERPD
LGGREIDDNRLASEAEEGGAWSGGAGGAHGGVCVEL
(51 a.a.)

- SilkBase 1999-2023 -