SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1390_internal:A_BomoASG_c8548_g1_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		ras_GTPase-activating-like_protein_IQGAP1_[Bombyx_mori]
Ontology
GO:0001726 C ruffle
GO:0001817 P regulation of cytokine production
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005547 F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005737 C cytoplasm
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005925 C focal adhesion
GO:0007165 P signal transduction
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007264 P small GTPase mediated signal transduction
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0015629 C actin cytoskeleton
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016328 C lateral plasma membrane
GO:0017048 F small GTPase binding
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0019904 F protein domain specific binding
GO:0030424 C axon
GO:0030426 C growth cone
GO:0030496 C midbody
GO:0030529 C ribonucleoprotein complex
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0031252 C cell leading edge
GO:0032403 F protein-containing complex binding
GO:0035305 P negative regulation of dephosphorylation
GO:0036057 C slit diaphragm
GO:0036120 P cellular response to platelet-derived growth factor stimulus
GO:0036464 C cytoplasmic ribonucleoprotein granule
GO:0043005 C neuron projection
GO:0043087 P regulation of GTPase activity
GO:0043234 C protein-containing complex
GO:0043539 F protein serine/threonine kinase activator activity
GO:0043547 P positive regulation of GTPase activity
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0044548 F S100 protein binding
GO:0045860 P positive regulation of protein kinase activity
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0048365 F small GTPase binding
GO:0070062 C extracellular exosome
GO:0071277 P cellular response to calcium ion
GO:0071364 P cellular response to epidermal growth factor stimulus
GO:0071902 P positive regulation of protein serine/threonine kinase activity
GO:0072015 P glomerular visceral epithelial cell development
GO:1990138 P neuron projection extension
RNA-seq EntryA_BomoASG_c8548_g1_i1
Sequence
(Amino Acid)
VQNRIALQDVAAFGLKLNNLVKHHSMTKLVFQNRPDGKGSFMTVTTAVKGLKSLTKESKR
LLDGYQHLFYELQTNPTYLSKLLFCIPQNKTNFFLQNVVLSLYNFGAYTRDE
(36 a.a.)

- SilkBase 1999-2023 -