SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG13850_5prime_partial:A_BomoASG_c28412_g1_i3
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		spastin_isoform_X2_[Bombyx_mori]
Ontology
GO:0000022 P mitotic spindle elongation
GO:0000070 P mitotic sister chromatid segregation
GO:0000166 F nucleotide binding
GO:0000226 P microtubule cytoskeleton organization
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007079 P mitotic chromosome movement towards spindle pole
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007626 P locomotory behavior
GO:0008017 F microtubule binding
GO:0008021 C synaptic vesicle
GO:0008152 P metabolic process
GO:0008344 P adult locomotory behavior
GO:0008568 F microtubule-severing ATPase activity
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0019226 P transmission of nerve impulse
GO:0019233 P sensory perception of pain
GO:0030154 P cell differentiation
GO:0031117 P positive regulation of microtubule depolymerization
GO:0031122 P cytoplasmic microtubule organization
GO:0031594 C neuromuscular junction
GO:0034214 P protein hexamerization
GO:0035099 P hemocyte migration
GO:0043014 F alpha-tubulin binding
GO:0043195 C terminal bouton
GO:0045834 P positive regulation of lipid metabolic process
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0048167 P regulation of synaptic plasticity
GO:0050775 P positive regulation of dendrite morphogenesis
GO:0050803 P regulation of synapse structure or activity
GO:0051013 P microtubule severing
GO:0051301 P cell division
GO:1900074 P negative regulation of neuromuscular synaptic transmission
GO:1900075 P positive regulation of neuromuscular synaptic transmission
GO:2000331 P regulation of terminal button organization
RNA-seq EntryA_BomoASG_c28412_g1_i3
Sequence
(Amino Acid)
FHESRILPCLRTTGKINVRFFVWKSVWRFRVREVRGSAFLMVSGDDSNGGRLSRKNTRSP
NRKSKKGDADLAKGSTLRNASQPSVHKRNLYVVSFPIIILFNILRSILYQLFLIFKYLYT
ASHRFMKKPRKIGECNLEVVVKDGIVSTEIAQEDMSHHVGPGDPLLAKQKHHHRKAFEYI
SKALKIDEENEGQKELAIELYKKGIFELERGIAVDCWGGRGDAWQRAQKLHDKMKTNLGM
AKDRLHFLANLVALSKLGVESEPERSDKKPTESPLKVRKPLEKSKTTLLSHTENNCGQTK
LPTEVAGRKLTTAGRRVPSSGGGPLMKSQTLPRSMGRSSSQPNSSNGGYTRYPMKPASTP
PAVKRQLSVPVNGSPVRRAVSGSQRGTPTRSRTPQPALTVRGVDPKLVQLILDEIVEGGP
KVNWDDIAGQEVSFVKVT
*(145 a.a.)

- SilkBase 1999-2023 -