SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG13848_internal:A_BomoASG_c28412_g1_i2
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		spastin-like_isoform_X3_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0000281 P mitotic cytokinesis
GO:0001578 P microtubule bundle formation
GO:0003824 F catalytic activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007049 P cell cycle
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0008017 F microtubule binding
GO:0008089 P anterograde axonal transport
GO:0008152 P metabolic process
GO:0008568 F microtubule-severing ATPase activity
GO:0010458 P exit from mitosis
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0019896 P axonal transport of mitochondrion
GO:0030154 P cell differentiation
GO:0030496 C midbody
GO:0031117 P positive regulation of microtubule depolymerization
GO:0031122 P cytoplasmic microtubule organization
GO:0031410 C cytoplasmic vesicle
GO:0031468 P nuclear membrane reassembly
GO:0031965 C nuclear membrane
GO:0032467 P positive regulation of cytokinesis
GO:0032506 P cytokinetic process
GO:0034214 P protein hexamerization
GO:0043014 F alpha-tubulin binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048487 F beta-tubulin binding
GO:0051013 P microtubule severing
GO:0051228 P mitotic spindle disassembly
GO:0051260 P protein homooligomerization
GO:0051301 P cell division
GO:0070062 C extracellular exosome
GO:0090148 P membrane fission
GO:1904115 C axon cytoplasm
RNA-seq EntryA_BomoASG_c28412_g1_i2
Sequence
(Amino Acid)
VCSSDLRSPARGLLLFGPPGNGKTLLARCVAAECSATFFSISAASLTSKYVGEGEKMVRA
LFQVARELQPSIIFVDEVDSLLCERSSGEHEASRRLKTEFLVEFDGLPAAGADRLIVMAA
TNRPQELDEATLRRFPKR
(45 a.a.)

- SilkBase 1999-2023 -