SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG13691_5prime_partial:A_BomoASG_c28327_g1_i2
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		forkhead_box_protein_P1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001701 P in utero embryonic development
GO:0002053 P positive regulation of mesenchymal cell proliferation
GO:0002329 P pre-B cell differentiation
GO:0002639 P positive regulation of immunoglobulin production
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007507 P heart development
GO:0007519 P skeletal muscle tissue development
GO:0008045 P motor neuron axon guidance
GO:0021517 P ventral spinal cord development
GO:0030324 P lung development
GO:0033152 P immunoglobulin V(D)J recombination
GO:0042803 F protein homodimerization activity
GO:0043565 F sequence-specific DNA binding
GO:0043621 F protein self-association
GO:0045214 P sarcomere organization
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048745 P smooth muscle tissue development
GO:0050679 P positive regulation of epithelial cell proliferation
GO:0055007 P cardiac muscle cell differentiation
GO:0060043 P regulation of cardiac muscle cell proliferation
GO:0061140 P lung secretory cell differentiation
GO:0061470 P T follicular helper cell differentiation
GO:0072358 P circulatory system development
GO:0072619 P interleukin-21 production
GO:1901249 P regulation of lung goblet cell differentiation
GO:1901250 P negative regulation of lung goblet cell differentiation
GO:2000727 P positive regulation of cardiac muscle cell differentiation
RNA-seq EntryA_BomoASG_c28327_g1_i2
Sequence
(Amino Acid)
HALDDRPAAQARVQMQVVAQLELQLRRERDRLAAMMRHLHAARDHHAHKHASGGPSEGTS
PGPVRRRVSDKSGVAIAGEIQRNREFYKTADVRPPFTYASLIRQAIIESPDKQLTLNEIY
NWFQSTFCYFRRNAATWKNAVRHNLSLHKCFMRVENVKGAVWTVDEVEFYKRRPQRAAHA
PPPMHHAGFMGAQSPPMMTSPHGYSEALKRNLQGMMEDCNLSYMSGEDHMMQTEDYPSSH
EEYSRPPILNGYGSSSSHEVKAEDLSANDTQDIKPNIYALKNEIQASDYSNKAGDYSNKE
SSSNRSGEGSSYDDYRPEDRYRPSISHIKDEAENLSLNEQRSEK
*(114 a.a.)

- SilkBase 1999-2023 -