SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1344_internal:A_BomoASG_c8126_g1_i1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
transcriptional_adapter_2B_isoform_X2_[Bombyx_mori]
Ontology
GO:0000124 C SAGA complex
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007412 P axon target recognition
GO:0008270 F zinc ion binding
GO:0016573 P histone acetylation
GO:0035066 P positive regulation of histone acetylation
GO:0035079 P polytene chromosome puffing
GO:0035222 P wing disc pattern formation
GO:0043966 P histone H3 acetylation
GO:0046872 F metal ion binding
GO:2000331 P regulation of terminal button organization
RNA-seq EntryA_BomoASG_c8126_g1_i1
Sequence
(Amino Acid)
RWMAQFYGRAEQACVSSGLWRERELRVRLAELHRYRLAGVTRLEECAHHDQHAALRRSTH
HDRNQWVPGNQSDKRSNIDQLAAAKKKRRRKRLKFHQPKVHT
(33 a.a.)

- SilkBase 1999-2023 -