SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG13441_complete:A_BomoASG_c28213_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
rab3_GTPase-activating_protein_catalytic_subunit_isoform_X2_[Bombyx_mori]
Ontology
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005737 C cytoplasm
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005811 C lipid droplet
GO:0007420 P brain development
GO:0010628 P positive regulation of gene expression
GO:0017112 F guanyl-nucleotide exchange factor activity
GO:0017137 F small GTPase binding
GO:0021854 P hypothalamus development
GO:0034389 P lipid droplet organization
GO:0043010 P camera-type eye development
GO:0043087 P regulation of GTPase activity
GO:0043234 C protein-containing complex
GO:0043547 P positive regulation of GTPase activity
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0060079 P excitatory postsynaptic potential
GO:0060325 P face morphogenesis
GO:0061646 P positive regulation of glutamate neurotransmitter secretion in response to membrane depolarization
GO:0070062 C extracellular exosome
GO:0071782 C endoplasmic reticulum tubular network
GO:0097051 P establishment of protein localization to endoplasmic reticulum membrane
GO:0098794 C postsynapse
GO:1903061 P positive regulation of protein lipidation
GO:1903233 P regulation of calcium ion-dependent exocytosis of neurotransmitter
GO:1903373 P positive regulation of endoplasmic reticulum tubular network organization
GO:2000786 P positive regulation of autophagosome assembly
RNA-seq EntryA_BomoASG_c28213_g1_i1
Sequence
(Amino Acid)
MPLLLISNIKKINLFQDPAPKTEDQLEEDAELMVRLGDDAKASELRARMMSASLLSDMEA
FKAANPGAELCDFVRWYSPRDWKSDDGGALGERMLLPGNPWVEAWNVARPVPASRQRRLF
DETREAEQILHFLRSRTVSGVAELLLPAIIRAGALRATQEGAIGSSASVGGVDARRTFEI
AVRELYEAEKEACRMLCRRKVLGGGEEGQALDAAERARVLRAAGGVLPAVARREFTLRVR
DATAPQLMRAALADDITIVGAFTERIVCL
*(89 a.a.)

- SilkBase 1999-2023 -