SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG13093_internal:A_BomoASG_c28040_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_trithorax_group_protein_osa_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001104 F transcription coregulator activity
GO:0003684 F damaged DNA binding
GO:0003690 F double-stranded DNA binding
GO:0004844 F uracil DNA N-glycosylase activity
GO:0005080 F protein kinase C binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005886 C plasma membrane
GO:0006281 P DNA repair
GO:0006284 P base-excision repair
GO:0006285 P base-excision repair, AP site formation
GO:0006298 P mismatch repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0008152 P metabolic process
GO:0008263 F pyrimidine-specific mismatch base pair DNA N-glycosylase activity
GO:0009790 P embryo development
GO:0016568 P chromatin organization
GO:0016605 C PML body
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0016799 F hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016925 P protein sumoylation
GO:0019104 F DNA N-glycosylase activity
GO:0030983 F mismatched DNA binding
GO:0032091 P negative regulation of protein binding
GO:0032183 F SUMO binding
GO:0035511 P oxidative DNA demethylation
GO:0035562 P negative regulation of chromatin binding
GO:0040029 P regulation of gene expression, epigenetic
GO:0042803 F protein homodimerization activity
GO:0043566 F DNA binding
GO:0045008 P depyrimidination
GO:0080111 P DNA demethylation
RNA-seq EntryA_BomoASG_c28040_g1_i1
Sequence
(Amino Acid)
EIKVEPGMEGALVPRPVKERKKHDRFNGMSEEEVSRRTLPDHLAENLDIIIIGINPGLFA
AYKGHHYAGPGNHFWKCLYLSGLTREQMSADEDYKLLNFGIGFTNMVPRPTKGSADLTRR
EIKEGSAVLLEKLQTFRPKVAVFNGKLIYEVFSGKKDFCFGKQPDTIAGTNTYMWVMPSS
SARCAQLPRAADKVPFYAALKKFRDYLNGLVAHVDESELVFPDTTSRRPQEEMEIRRLTM
EPEPGDTIILEDGTEVPLKKKRGRPKKVKLENGETAPPIPRAPRQPRPPPVLDPNGEQPP
KKKRGRPKKIRPEEQQFLLQQQQQQQQQQ
(108 a.a.)

- SilkBase 1999-2023 -