SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG13019_complete:A_BomoASG_c28004_g1_i3
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
CCR4-NOT_transcription_complex_subunit_7_isoform_X2_[Bombyx_mori]
Ontology
GO:0000175 F 3'-5'-exoribonuclease activity
GO:0000289 P nuclear-transcribed mRNA poly(A) tail shortening
GO:0000290 P deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000932 C P-body
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0004518 F nuclease activity
GO:0004527 F exonuclease activity
GO:0004532 F exoribonuclease activity
GO:0004535 F poly(A)-specific ribonuclease activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006417 P regulation of translation
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0010629 P negative regulation of gene expression
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0030014 C CCR4-NOT complex
GO:0031047 P gene silencing by RNA
GO:0033962 P P-body assembly
GO:0043928 P exonucleolytic catabolism of deadenylated mRNA
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0060213 P positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0061014 P positive regulation of mRNA catabolic process
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
GO:1900153 P positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
RNA-seq EntryA_BomoASG_c28004_g1_i3
Sequence
(Amino Acid)
MDENAKTPPGCTTWQFNFKFNLQEDMYAQDSIDLLQNSGLQFREHEEHGIEPLEFAELLM
SSGIVLMDNINWLSFHSGYDFGYLLKLLTDQNLPHEENDFFERLRLYFPTVYDVKYLMKL
CKNLKGGLQEVADQLELRRVGPQHQAGSDSLLTGMAFFKIKEIFFDGNIESTSGHLYGLG
APFTTNANNFQDNVDSGNSP
*(66 a.a.)

- SilkBase 1999-2023 -