SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG12910_complete:A_BomoASG_c27947_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
tenascin_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0005102 F signaling receptor binding
GO:0005634 C nucleus
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005911 C cell-cell junction
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007155 P cell adhesion
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007165 P signal transduction
GO:0007411 P axon guidance
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016337 P cell-cell adhesion
GO:0016605 C PML body
GO:0030054 C cell junction
GO:0030175 C filopodium
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0035584 P calcium-mediated signaling using intracellular calcium source
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043197 C dendritic spine
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046982 F protein heterodimerization activity
GO:0050839 F cell adhesion molecule binding
GO:0051491 P positive regulation of filopodium assembly
GO:0097264 P self proteolysis
RNA-seq EntryA_BomoASG_c27947_g1_i1
Sequence
(Amino Acid)
MGGWQLIFVALLGLATAQGPEKRRTGNVCNVDMDCPDNAFCRLNSYCVCKEGYVYAAINS
TNKGCLKEARNGEACVQNIQCHMTMGVHSECTGGSCACAPTAHLDGERCYETALIGERCV
VDQNCYLGEQGIERQAFCVRGYCTCQLQFSPRDNGTRCVRDAALGEECEDQLQCAGPGLE
CRGTCRCRDNWVANNHTNSCVECE
*(67 a.a.)

- SilkBase 1999-2023 -