SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG12864_internal:A_BomoASG_c27917_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
verprolin_isoform_X3_[Bombyx_mori]
Ontology
GO:0001105 F transcription coactivator activity
GO:0001701 P in utero embryonic development
GO:0001764 P neuron migration
GO:0001889 P liver development
GO:0003007 P heart morphogenesis
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007507 P heart development
GO:0007517 P muscle organ development
GO:0010467 P gene expression
GO:0010468 P regulation of gene expression
GO:0030036 P actin cytoskeleton organization
GO:0030154 P cell differentiation
GO:0030900 P forebrain development
GO:0031175 P neuron projection development
GO:0045844 P positive regulation of striated muscle tissue development
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048514 P blood vessel morphogenesis
GO:0048568 P embryonic organ development
GO:0048738 P cardiac muscle tissue development
GO:0051145 P smooth muscle cell differentiation
RNA-seq EntryA_BomoASG_c27917_g1_i1
Sequence
(Amino Acid)
APPSALSSLSPSLPVASRFEDMKVSDLRAECKRRNLRVSGPKPQLIDRLRPFLVEKQEEA
PKSPVSVASVPSVASMVSIASPDPRIKIEPQEDIVQSQRRQIEELERKLEVSRQQLEAVR
REAAGAAASDQGRRLLQAHLCVTQLRAKLDALQQSPPPPPQPQYVRLFTMTPPAPNLDTT
VDSTLQKPANPAYILNGVKVVPIAILPTTHYEPERLAPPPPPPPPPPPPPPP
(76 a.a.)

- SilkBase 1999-2023 -