SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG12758_3prime_partial:A_BomoASG_c27814_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
death_related_ced-3/Nedd2-like_protein_[Bombyx_mori]
Ontology
GO:0002230 P positive regulation of defense response to virus by host
GO:0002376 P immune system process
GO:0004175 F endopeptidase activity
GO:0004197 F cysteine-type endopeptidase activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0006508 P proteolysis
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006952 P defense response
GO:0006955 P immune response
GO:0006963 P positive regulation of antibacterial peptide biosynthetic process
GO:0006964 P positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
GO:0007291 P sperm individualization
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008656 F cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0016485 P protein processing
GO:0016787 F hydrolase activity
GO:0043069 P negative regulation of programmed cell death
GO:0045087 P innate immune response
GO:0045089 P positive regulation of innate immune response
GO:0048935 P peripheral nervous system neuron development
GO:0050829 P defense response to Gram-negative bacterium
GO:0061057 P peptidoglycan recognition protein signaling pathway
GO:0097194 P execution phase of apoptosis
GO:0097200 F cysteine-type endopeptidase activity involved in execution phase of apoptosis
RNA-seq EntryA_BomoASG_c27814_g1_i1
Sequence
(Amino Acid)
MFRPDALDERAALDRQIIHSNLINVDVISQIERELQDEPYDMVSLVFLLYEVPDTALQKL
VTHQKIVTEMLGTNLNLLHDWYQHSKSKPTWKHEFLEALLICQLFNIVRRIGFDVQTLRK
HYQTDYPGLSMYVDPLRKILYKICEEIDTPNLIKLQKSLLTYDIDVSGHNICEIILLELM
SRRFIGI
(61 a.a.)

- SilkBase 1999-2023 -