SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG12673_5prime_partial:A_BomoASG_c27772_g1_i2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
copper-transporting_ATPase_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001568 P blood vessel development
GO:0001701 P in utero embryonic development
GO:0001974 P blood vessel remodeling
GO:0002082 P regulation of oxidative phosphorylation
GO:0004008 F P-type divalent copper transporter activity
GO:0005375 F copper ion transmembrane transporter activity
GO:0005507 F copper ion binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005770 C late endosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006568 P tryptophan metabolic process
GO:0006584 P catecholamine metabolic process
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006825 P copper ion transport
GO:0006878 P cellular copper ion homeostasis
GO:0007005 P mitochondrion organization
GO:0007595 P lactation
GO:0007626 P locomotory behavior
GO:0010041 P response to iron(III) ion
GO:0010043 P response to zinc ion
GO:0010273 P detoxification of copper ion
GO:0015677 P copper ion import
GO:0015679 P plasma membrane copper ion transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016532 F superoxide dismutase copper chaperone activity
GO:0016787 F hydrolase activity
GO:0018205 P peptidyl-lysine modification
GO:0019430 P removal of superoxide radicals
GO:0019829 F ATPase-coupled cation transmembrane transporter activity
GO:0021702 P cerebellar Purkinje cell differentiation
GO:0021860 P pyramidal neuron development
GO:0021954 P central nervous system neuron development
GO:0030001 P metal ion transport
GO:0030140 C trans-Golgi network transport vesicle
GO:0030141 C secretory granule
GO:0030198 P extracellular matrix organization
GO:0030199 P collagen fibril organization
GO:0031069 P hair follicle morphogenesis
GO:0031526 C brush border membrane
GO:0032767 F copper-dependent protein binding
GO:0034220 P ion transmembrane transport
GO:0042093 P T-helper cell differentiation
GO:0042414 P epinephrine metabolic process
GO:0042415 P norepinephrine metabolic process
GO:0042417 P dopamine metabolic process
GO:0042428 P serotonin metabolic process
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043085 P positive regulation of catalytic activity
GO:0043473 P pigmentation
GO:0043588 P skin development
GO:0046688 P response to copper ion
GO:0046872 F metal ion binding
GO:0048251 P elastic fiber assembly
GO:0048286 P lung alveolus development
GO:0048471 C perinuclear region of cytoplasm
GO:0048553 P negative regulation of catalytic activity
GO:0048554 P positive regulation of catalytic activity
GO:0048812 P neuron projection morphogenesis
GO:0051216 P cartilage development
GO:0051353 P positive regulation of oxidoreductase activity
GO:0051542 P elastin biosynthetic process
GO:0060003 P copper ion export
RNA-seq EntryA_BomoASG_c27772_g1_i2
Sequence
(Amino Acid)
VAMVGDGVNDSPALAQADVGIAIASGTDVAVEAADLVLMRNDLLDVVACLNLSRTTVRRV
RLNFLFASVYNLLGIPLASGAFALYGMQLQPWMASAAMAMSSVSVVCSSLLLKTFRKPTI
EELRTPEYLQSIRLEDLDSVSVHRGLDERVDPSDRSVTALSKFFNRAKADEGCLLQDDDE
LAAVSFIPKQLSRDSPSLNA
*(66 a.a.)

- SilkBase 1999-2023 -