SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG12662_3prime_partial:A_BomoASG_c27764_g1_i1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		PREDICTED:_dynein_heavy_chain,_cytoplasmic_[Plutella_xylostella]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0003774 F cytoskeletal motor activity
GO:0003777 F microtubule motor activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005868 C cytoplasmic dynein complex
GO:0005874 C microtubule
GO:0006810 P transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007018 P microtubule-based movement
GO:0007052 P mitotic spindle organization
GO:0008152 P metabolic process
GO:0016020 C membrane
GO:0016887 F ATP hydrolysis activity
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0030175 C filopodium
GO:0030286 C dynein complex
GO:0033962 P P-body assembly
GO:0034063 P stress granule assembly
GO:0044822 F RNA binding
GO:0051293 P establishment of spindle localization
GO:0051959 F dynein light intermediate chain binding
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoASG_c27764_g1_i1
Sequence
(Amino Acid)
MFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIEALHEKFKVQYPQSKCSSISTVRD
LPPVAGSIIWAKQIDHQLTAYLKRVEDVLGKGWENHIEGQKLKADGDSFRLKLDTQEVFD
DWARKVQQRNLGVSGRIFAIDSVRARSSKTGTILKLKVNFLPEIITLYKR
(55 a.a.)

- SilkBase 1999-2023 -