SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1233_internal:A_BomoASG_c7382_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
ephrin_type-B_receptor_1-B_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005003 F ephrin receptor activity
GO:0005004 F GPI-linked ephrin receptor activity
GO:0005524 F ATP binding
GO:0005769 C early endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0010717 P regulation of epithelial to mesenchymal transition
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0032956 P regulation of actin cytoskeleton organization
GO:0043087 P regulation of GTPase activity
GO:0048013 P ephrin receptor signaling pathway
GO:0051893 P regulation of focal adhesion assembly
GO:0070507 P regulation of microtubule cytoskeleton organization
GO:0097155 P fasciculation of sensory neuron axon
GO:0097156 P fasciculation of motor neuron axon
RNA-seq EntryA_BomoASG_c7382_g1_i1
Sequence
(Amino Acid)
GLNSTRVTISGLDPVTEYKFQVYAENGVSELSPDPAKHIEITAVTEASVVSVVSKLRILN
TESDRLTIAWNPPQVDLTDPDDTIESYEVKCFPKDSQDKNTNTTLRITKDPQVTITGLRK
DTEYGIRVRAKMKRGWGEFSGIVYARTNSVTETSFIDEEG
(52 a.a.)

- SilkBase 1999-2023 -