SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG12295_5prime_partial:A_BomoASG_c27516_g1_i3
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
uncharacterized_protein_LOC767623_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001933 P negative regulation of protein phosphorylation
GO:0003779 F actin binding
GO:0005737 C cytoplasm
GO:0005844 C polysome
GO:0006417 P regulation of translation
GO:0006446 P regulation of translational initiation
GO:0007399 P nervous system development
GO:0030154 P cell differentiation
GO:0031333 P negative regulation of protein-containing complex assembly
GO:0031953 P negative regulation of protein autophosphorylation
GO:0034198 P cellular response to amino acid starvation
GO:0042149 P cellular response to glucose starvation
GO:0043022 F ribosome binding
GO:0045666 P positive regulation of neuron differentiation
GO:0060548 P negative regulation of cell death
GO:0060733 P GCN2-mediated signaling
GO:0070301 P cellular response to hydrogen peroxide
GO:0071264 P positive regulation of translational initiation in response to starvation
GO:0071468 P cellular response to acidic pH
GO:0071494 P cellular response to UV-C
GO:0072755 P cellular response to benomyl
GO:0097201 P negative regulation of transcription from RNA polymerase II promoter in response to stress
GO:1990138 P neuron projection extension
GO:1990253 P cellular response to leucine starvation
RNA-seq EntryA_BomoASG_c27516_g1_i3
Sequence
(Amino Acid)
IGRASSPPKFELSAPWMDRQTKTNLHKTLHEIYLDNVGETVIFQWVEMIREVLQTVCKVE
KKIEVTEPKVDSLDLTTIEINCPEITHGEIIADRKSIFQGHAAEVHSIDDVKAVLNKLKQ
NRKILNATHNMYAYRIERKTAKGTNVLQDCDDDGEAHAGGRMLHLLQVLNQKNTLVVVSR
WYGGVQLGPDRFRHINNASRQVIQQAGLLKK
*(69 a.a.)

- SilkBase 1999-2023 -