SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG12173_5prime_partial:A_BomoASG_c27441_g1_i3
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
vacuolar_protein_sorting-associated_protein_33A-like_[Bombyx_mori]
Ontology
GO:0000149 F SNARE binding
GO:0005515 F protein binding
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0006622 P protein targeting to lysosome
GO:0006727 P ommochrome biosynthetic process
GO:0006810 P transport
GO:0006897 P endocytosis
GO:0006904 P vesicle docking involved in exocytosis
GO:0007032 P endosome organization
GO:0007040 P lysosome organization
GO:0007220 P Notch receptor processing
GO:0008057 P eye pigment granule organization
GO:0008333 P endosome to lysosome transport
GO:0008340 P determination of adult lifespan
GO:0008593 P regulation of Notch signaling pathway
GO:0009267 P cellular response to starvation
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0016197 P endosomal transport
GO:0019905 F syntaxin binding
GO:0030897 C HOPS complex
GO:0031396 P regulation of protein ubiquitination
GO:0031902 C late endosome membrane
GO:0033263 C CORVET complex
GO:0035542 P regulation of SNARE complex assembly
GO:0045746 P negative regulation of Notch signaling pathway
GO:0046907 P intracellular transport
GO:0048072 P compound eye pigmentation
GO:0097352 P autophagosome maturation
RNA-seq EntryA_BomoASG_c27441_g1_i3
Sequence
(Amino Acid)
LQVPGSCIQDVLGLLPGPTVDELQTLQPRMTRRHSGSSENSSSIENPRVVLVFFIGGCTY
HEISVLRTISQQEDSVVEFVILTTKIINGTTFIESLMELD
*(32 a.a.)

- SilkBase 1999-2023 -