SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG12159_internal:A_BomoASG_c27436_g1_i3
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
putative_DNA_helicase_Ino80_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000790 C chromatin
GO:0000975 F transcription cis-regulatory region binding
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0010468 P regulation of gene expression
GO:0016568 P chromatin organization
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0031011 C Ino80 complex
GO:0032508 P DNA duplex unwinding
GO:0040034 P regulation of development, heterochronic
GO:0045892 P negative regulation of transcription, DNA-templated
RNA-seq EntryA_BomoASG_c27436_g1_i3
Sequence
(Amino Acid)
ALPICCKRLSREMQAYWRRYDRAERETRRRMEKEAEEQRKMDVELMEAKRQRRKLNFLIT
QTELYAHFMQRKMSAVEDSDTGADHILRQLDEDRDPRLASIDCYDSEEMKA
(36 a.a.)

- SilkBase 1999-2023 -