SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG12062_internal:A_BomoASG_c27389_g2_i2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		histone-lysine_N-methyltransferase_SUV39H2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000775 C chromosome, centromeric region
GO:0000785 C chromatin
GO:0000976 F transcription cis-regulatory region binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0006333 P chromatin assembly or disassembly
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0030154 P cell differentiation
GO:0032259 P methylation
GO:0034968 P histone lysine methylation
GO:0036123 P histone H3-K9 dimethylation
GO:0036124 P histone H3-K9 trimethylation
GO:0042754 P negative regulation of circadian rhythm
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0046974 F histone methyltransferase activity (H3-K9 specific)
GO:0048511 P rhythmic process
GO:0071456 P cellular response to hypoxia
RNA-seq EntryA_BomoASG_c27389_g2_i2
Sequence
(Amino Acid)
RSEEQKISVQNNVDFAGPPENFTYINQSIPGTGVIIPDEPPIGCECTACNCRSKSCCGMQ
AGFFAYTINKRLRVAPGTPIYECNKACKCSSECSNRVVQNGRNIKLTIFKTSNGCGWGVK
TEQKIREGQFICQYIGEVISFEEAEKRGREYDANGLTYLFDLDFNSVENPYVDAAHLGNI
SHFINHSCDPNLGVWAVWADCLDPNLP
(68 a.a.)

- SilkBase 1999-2023 -