SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1180_internal:A_BomoASG_c7012_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
antimicrobial_protein_6Tox_precursor_[Bombyx_mori]
Ontology
GO:0001649 P osteoblast differentiation
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005604 C basement membrane
GO:0005614 C interstitial matrix
GO:0005615 C extracellular space
GO:0005925 C focal adhesion
GO:0007155 P cell adhesion
GO:0007162 P negative regulation of cell adhesion
GO:0007528 P neuromuscular junction development
GO:0008284 P positive regulation of cell population proliferation
GO:0009611 P response to wounding
GO:0009612 P response to mechanical stimulus
GO:0010628 P positive regulation of gene expression
GO:0014012 P peripheral nervous system axon regeneration
GO:0016020 C membrane
GO:0030198 P extracellular matrix organization
GO:0031012 C extracellular matrix
GO:0031175 P neuron projection development
GO:0042060 P wound healing
GO:0042127 P regulation of cell population proliferation
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0045471 P response to ethanol
GO:0045545 F syndecan binding
GO:0060447 P bud outgrowth involved in lung branching
GO:0060739 P mesenchymal-epithelial cell signaling involved in prostate gland development
GO:0060740 P prostate gland epithelium morphogenesis
GO:0071300 P cellular response to retinoic acid
GO:0071305 P cellular response to vitamin D
GO:0071774 P response to fibroblast growth factor
GO:0071799 P cellular response to prostaglandin D stimulus
RNA-seq EntryA_BomoASG_c7012_g1_i1
Sequence
(Amino Acid)
VLFRSDQSCRRIGFPGGVCVNGRCKCDIIANNNIADLDEDRSSLKDCNSRGCDQSCRRIG
FPGGVCVNGRCKCDIIANNNIADLDEDRSSLKDCNSRGCDQSCRRIGFPGGVCVNG
(37 a.a.)

- SilkBase 1999-2023 -