SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1172_internal:A_BomoASG_c6900_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
protein_pangolin,_isoforms_A/H/I/S_isoform_X7_[Helicoverpa_armigera]
Ontology
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005875 C microtubule associated complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007367 P segment polarity determination
GO:0007435 P salivary gland morphogenesis
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007500 P mesodermal cell fate determination
GO:0007507 P heart development
GO:0008013 F beta-catenin binding
GO:0009880 P embryonic pattern specification
GO:0010628 P positive regulation of gene expression
GO:0016055 P Wnt signaling pathway
GO:0019900 F kinase binding
GO:0030111 P regulation of Wnt signaling pathway
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045610 P regulation of hemocyte differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0060070 P canonical Wnt signaling pathway
GO:0070491 F DNA-binding transcription factor binding
GO:0072091 P regulation of stem cell proliferation
RNA-seq EntryA_BomoASG_c6900_g1_i1
Sequence
(Amino Acid)
LSREEQAKYYEKARQERQLHMQLYPGWSARDNYGYGSKKKKRKKDRSPAELGGNNLKKCR
ARFGLDQQNQWCKPCRRKKKCMRYMEALAAAASGGDNLP
(32 a.a.)

- SilkBase 1999-2023 -