SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG11705_3prime_partial:A_BomoASG_c27153_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		blood_vessel_epicardial_substance_isoform_X3_[Bombyx_mori]
Ontology
GO:0001921 P positive regulation of receptor recycling
GO:0002027 P regulation of heart rate
GO:0002244 P hematopoietic progenitor cell differentiation
GO:0005198 F structural molecule activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005923 C bicellular tight junction
GO:0007155 P cell adhesion
GO:0007275 P multicellular organism development
GO:0007507 P heart development
GO:0007519 P skeletal muscle tissue development
GO:0008360 P regulation of cell shape
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016192 P vesicle-mediated transport
GO:0016328 C lateral plasma membrane
GO:0030054 C cell junction
GO:0030552 F cAMP binding
GO:0031253 C cell projection membrane
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0040017 P positive regulation of locomotion
GO:0042383 C sarcolemma
GO:0042391 P regulation of membrane potential
GO:0043087 P regulation of GTPase activity
GO:0048278 P vesicle docking
GO:0060931 P sinoatrial node cell development
GO:0060973 P cell migration involved in heart development
GO:0090136 P epithelial cell-cell adhesion
GO:2001135 P regulation of endocytic recycling
RNA-seq EntryA_BomoASG_c27153_g1_i1
Sequence
(Amino Acid)
MMLIISALITGMVTGLQNITTESPSMISDITTSLNTKDKVPEMGLVEPTKLSLPTSDMVN
VSIHDQPSMWDLYLHHCSKWRPINHIFFQVANIFFLMSFLAPHTDIGQIWLRVGLMMGCA
FSGMWAWSVECYLDAVLWNSVFILINFVYFSYQFYLMRPIKFHKEIEEVYLALFKPLRVS
RRQFRRVLMCMRNVRHLKCHELYAHEKVTKVDSLSLVLSGKLVVSQNQREIGR
(76 a.a.)

- SilkBase 1999-2023 -