SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1169_5prime_partial:A_BomoASG_c6852_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		ATP-binding_cassette_sub-family_C_member_Sur_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0008152 P metabolic process
GO:0008361 P regulation of cell size
GO:0009637 P response to blue light
GO:0009639 P response to red or far red light
GO:0009640 P photomorphogenesis
GO:0009733 P response to auxin
GO:0009734 P auxin-activated signaling pathway
GO:0009926 P auxin polar transport
GO:0009958 P positive gravitropism
GO:0010160 P formation of animal organ boundary
GO:0010218 P response to far red light
GO:0010315 P auxin efflux
GO:0010329 F auxin efflux transmembrane transporter activity
GO:0010540 P basipetal auxin transport
GO:0010541 P acropetal auxin transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0043481 P anthocyanin accumulation in tissues in response to UV light
GO:0048364 P root development
GO:0048443 P stamen development
GO:0048527 P lateral root development
GO:0055085 P transmembrane transport
GO:0060918 P auxin transport
RNA-seq EntryA_BomoASG_c6852_g1_i1
Sequence
(Amino Acid)
AGRAARACAARAALHARLAAALLLDEPAAALDAAAERALLAAMARIAPDTTIITVAHRIS
SVRGYDRAVVLEEGRVVEQGEVGPLLSRPVSRLARMLAAAHTHV
*(34 a.a.)

- SilkBase 1999-2023 -