SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG11640_5prime_partial:A_BomoASG_c27112_g1_i2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
zinc_transporter_1_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0005385 F zinc ion transmembrane transporter activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006829 P zinc ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006882 P cellular zinc ion homeostasis
GO:0008324 F cation transmembrane transporter activity
GO:0010043 P response to zinc ion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019855 F calcium channel inhibitor activity
GO:0030315 C T-tubule
GO:0031965 C nuclear membrane
GO:0046929 P negative regulation of neurotransmitter secretion
GO:0055085 P transmembrane transport
GO:0061088 P regulation of sequestering of zinc ion
GO:0070509 P calcium ion import
GO:0070574 P cadmium ion transmembrane transport
GO:0071577 P zinc ion transmembrane transport
GO:0071584 P negative regulation of zinc ion transmembrane import
GO:0071585 P detoxification of cadmium ion
GO:0090281 P negative regulation of calcium ion import
RNA-seq EntryA_BomoASG_c27112_g1_i2
Sequence
(Amino Acid)
VIVGSAVIGLLFNAINYMLLAGRELSYSRRLSVTEGGGVVLKTGSGEPVLAHAPTDIASS
LFVIAAGLTEEWEHEASRIADPALSACAAIVLVVFNYPFMRSAGLVLLQTVPEGLGACDL
RTAALRVPGVFAIHELHVWQLHRDKVVATAHVIYGTHEDYLKNSALVCDVFKRHGIGLVT
LQPEFMLTSSRGTEEEKKELIAYGNLGCSCPCVKECTGPRCCEPPNIPPIIRI
*(77 a.a.)

- SilkBase 1999-2023 -