SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG11528_complete:A_BomoASG_c27045_g1_i1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
uncharacterized_protein_LOC101746834_[Bombyx_mori]
Ontology
GO:0001923 P B-1 B cell differentiation
GO:0002020 F protease binding
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0002237 P response to molecule of bacterial origin
GO:0002726 P positive regulation of T cell cytokine production
GO:0004197 F cysteine-type endopeptidase activity
GO:0004842 F ubiquitin-protein transferase activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0006952 P defense response
GO:0007250 P activation of NF-kappaB-inducing kinase activity
GO:0008233 F peptidase activity
GO:0009620 P response to fungus
GO:0016567 P protein ubiquitination
GO:0016787 F hydrolase activity
GO:0019209 F kinase activator activity
GO:0031398 P positive regulation of protein ubiquitination
GO:0032449 C CBM complex
GO:0032743 P positive regulation of interleukin-2 production
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0042098 P T cell proliferation
GO:0042113 P B cell activation
GO:0042981 P regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043234 C protein-containing complex
GO:0043621 F protein self-association
GO:0045087 P innate immune response
GO:0048471 C perinuclear region of cytoplasm
GO:0050852 P T cell receptor signaling pathway
GO:0050856 P regulation of T cell receptor signaling pathway
GO:0050870 P positive regulation of T cell activation
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051168 P nuclear export
GO:0051259 P protein complex oligomerization
RNA-seq EntryA_BomoASG_c27045_g1_i1
Sequence
(Amino Acid)
MSLLQKLAYNDYKKAKDFTVHQCETIANLAKLNTTFTNVECPGEHLLRKLDLSGCSVSQY
KVLLSALRKYRPHSKIAVLIANNLYTHLSKLATPSVDCDSLSLHLKSLGFIVVTVKNTHA
SHLKDIVGRISHVIPPDSYCFIFYAGHGCQIGNTKCMLGIDCPTENIQNEHCMTENNMLK
QFERCNLDLCVFILDMCRINLDRETNPDISNSIVFTEDYIVHKNLLISYSTQSSQSAYEV
LEIECSTTINFDETYELKTGDTDRIVPGASQYVKALCNRIGEDCDVSSLLDRVHGDVENS
LRKQKPIKVQCGVEKRQLNDVPNCEPITLINKLKESIKDYTNYCDVF
*(115 a.a.)

- SilkBase 1999-2023 -