SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG11374_5prime_partial:A_BomoASG_c26989_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		transmembrane_GTPase_Marf_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005739 C mitochondrion
GO:0005740 C mitochondrial envelope
GO:0005741 C mitochondrial outer membrane
GO:0005886 C plasma membrane
GO:0006697 P ecdysone biosynthetic process
GO:0007005 P mitochondrion organization
GO:0007029 P endoplasmic reticulum organization
GO:0008053 P mitochondrial fusion
GO:0008344 P adult locomotory behavior
GO:0010636 P positive regulation of mitochondrial fusion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0019896 P axonal transport of mitochondrion
GO:0031966 C mitochondrial membrane
GO:0034389 P lipid droplet organization
GO:0034976 P response to endoplasmic reticulum stress
GO:0070584 P mitochondrion morphogenesis
GO:0090140 P regulation of mitochondrial fission
GO:1904115 C axon cytoplasm
RNA-seq EntryA_BomoASG_c26989_g1_i1
Sequence
(Amino Acid)
EEWGLLSKFALGALTSQGTMGGLLLSGLLLKTVGWRVLAVTGLAYGALYAYERLTWTAKA
QERVFKRQYVAHAGKKLRLIVDLTSANCSHQVQQELSTMFARLCRLIDEATTEMDAELSG
VRDAIKMLDDASTSAKKLRNKANYLSHELELFEEAFLKHNN
*(53 a.a.)

- SilkBase 1999-2023 -