| Name | O_BomoASG11356_5prime_partial:A_BomoASG_c26969_g1_i2 |
| Scaffold_id | Bomo_Chr12 |
NCBI non-redundant
(nr) | WD_repeat_and_FYVE_domain-containing_protein_3_[Helicoverpa_armigera] |
| Ontology |
| GO:0003831 |
F |
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity |
| GO:0005515 |
F |
protein binding |
| GO:0005545 |
F |
1-phosphatidylinositol binding |
| GO:0005634 |
C |
nucleus |
| GO:0005635 |
C |
nuclear envelope |
| GO:0005737 |
C |
cytoplasm |
| GO:0005776 |
C |
autophagosome |
| GO:0006914 |
P |
autophagy |
| GO:0008152 |
P |
metabolic process |
| GO:0016020 |
C |
membrane |
| GO:0016234 |
C |
inclusion body |
| GO:0016239 |
P |
positive regulation of macroautophagy |
| GO:0016605 |
C |
PML body |
| GO:0019898 |
C |
extrinsic component of membrane |
| GO:0031965 |
C |
nuclear membrane |
| GO:0034274 |
C |
Atg12-Atg5-Atg16 complex |
| GO:0035973 |
P |
aggrephagy |
| GO:0046872 |
F |
metal ion binding |
| GO:0097635 |
C |
extrinsic component of autophagosome membrane |
|
| RNA-seq Entry | A_BomoASG_c26969_g1_i2 |
Sequence
(Amino Acid) | RRDNVSPAAVTAAAAPRSGRGLAVGDARGRIFRWSAPDMSSASGAKGGPADHWVRDDTAP
YCTQCQVRFTALERRHHCRECGAVFCGRCSRYEAPVRRLRALRPVRVCQRCHDNIHGKKE
*(39 a.a.) |
