SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1130_3prime_partial:A_BomoASG_c6682_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		DNA_topoisomerase_2-binding_protein_1_[Bombyx_mori]
Ontology
GO:0000076 P DNA replication checkpoint signaling
GO:0000785 C chromatin
GO:0000922 C spindle pole
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005656 C nuclear pre-replicative complex
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006260 P DNA replication
GO:0006267 P pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006270 P DNA replication initiation
GO:0006271 P DNA strand elongation involved in DNA replication
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0019900 F kinase binding
GO:0030174 P regulation of DNA-dependent DNA replication initiation
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0035563 P positive regulation of chromatin binding
GO:0045860 P positive regulation of protein kinase activity
GO:0071163 P DNA replication preinitiation complex assembly
GO:0071165 P GINS complex assembly
GO:0071168 P protein localization to chromatin
RNA-seq EntryA_BomoASG_c6682_g1_i1
Sequence
(Amino Acid)
MGGIYNSVLTDDSTHLVSDTVLSDKYIKSVEKGIPVMSETWIEAVWEASQRMNISGSSGE
FDIHRLPAFANLQVTTSGISKRDKQMIMKLVNENGGMFSGVFQSETTDVVVLMKDGAGSE
KYKAALEYGKACVLPSWVKESAARGVALPVLKYKITAASTSSPLAEHRLPDMSLNFSRIT
NVRPPSNFVDETRSVDVSTVSAKMKLSQDAISSDTSIDKELQAEFDNLDMSTIKKAGSIF
DGFCIWLVG
(82 a.a.)

- SilkBase 1999-2023 -