SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1128_internal:A_BomoASG_c6675_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_probable_E3_ubiquitin-protein_ligase_HERC2_[Helicoverpa_armigera]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005743 C mitochondrial inner membrane
GO:0005814 C centriole
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006886 P intracellular protein transport
GO:0006974 P cellular response to DNA damage stimulus
GO:0007283 P spermatogenesis
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0016925 P protein sumoylation
GO:0031625 F ubiquitin protein ligase binding
GO:0032183 F SUMO binding
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043547 P positive regulation of GTPase activity
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoASG_c6675_g1_i1
Sequence
(Amino Acid)
CALPIWAVQGFGDNEGGAPRTIASLSVLRITRVYTGEHFHAVLTDNGQVYTWGKGDNYRL
GHGNLENVKLPKVMGAFQGIRIIDVSLGLCHGVALTSEGAVYAWGTHER
(35 a.a.)

- SilkBase 1999-2023 -