SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG11275_5prime_partial:A_BomoASG_c26905_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)		WASH_complex_subunit_1_[Bombyx_mori]
Ontology
GO:0001578 P microtubule bundle formation
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005829 C cytosol
GO:0006810 P transport
GO:0015031 P protein transport
GO:0030154 P cell differentiation
GO:0031941 C filamentous actin
GO:0034314 P Arp2/3 complex-mediated actin nucleation
GO:0035210 P prepupal development
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043014 F alpha-tubulin binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048477 P oogenesis
GO:0051017 P actin filament bundle assembly
GO:0051020 F GTPase binding
GO:0051764 P actin crosslink formation
GO:0071203 C WASH complex
RNA-seq EntryA_BomoASG_c26905_g1_i1
Sequence
(Amino Acid)
PPPPPPPMKEVELTPSKREEKVSPLSPPGTGDAHADLMAAIRSAGGAGRAKLRHAVDSEA
PESTKPASTGDLMADLHAKLSMRRRGISGAERAGGSVLHTLASIIPEPGDQSSPQHSSGD
EDWD
*(40 a.a.)

- SilkBase 1999-2023 -