SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG11261_5prime_partial:A_BomoASG_c26891_g2_i2
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		dynactin_subunit_1_[Bombyx_mori]
Ontology
GO:0000776 C kinetochore
GO:0001709 P cell fate determination
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0001754 P eye photoreceptor cell differentiation
GO:0003774 F cytoskeletal motor activity
GO:0003777 F microtubule motor activity
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005813 C centrosome
GO:0005818 C aster
GO:0005828 C kinetochore microtubule
GO:0005856 C cytoskeleton
GO:0005869 C dynactin complex
GO:0005874 C microtubule
GO:0005876 C spindle microtubule
GO:0006886 P intracellular protein transport
GO:0007018 P microtubule-based movement
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007349 P cellularization
GO:0008090 P retrograde axonal transport
GO:0010970 P transport along microtubule
GO:0016330 P second mitotic wave involved in compound eye morphogenesis
GO:0022008 P neurogenesis
GO:0030286 C dynein complex
GO:0030496 C midbody
GO:0031616 C spindle pole centrosome
GO:0034501 P protein localization to kinetochore
GO:0035011 P melanotic encapsulation of foreign target
GO:0035371 C microtubule plus-end
GO:0042051 P compound eye photoreceptor development
GO:0042052 P rhabdomere development
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0045502 F dynein complex binding
GO:0047497 P mitochondrion transport along microtubule
GO:0048477 P oogenesis
GO:0048491 P retrograde synaptic vesicle transport
GO:0048675 P axon extension
GO:0051028 P mRNA transport
GO:0051225 P spindle assembly
GO:0051256 P mitotic spindle midzone assembly
GO:0051299 P centrosome separation
GO:0051383 P kinetochore organization
GO:0051642 P centrosome localization
GO:0070840 F dynein complex binding
GO:1904115 C axon cytoplasm
RNA-seq EntryA_BomoASG_c26891_g2_i2
Sequence
(Amino Acid)
CSSDLMDHLQHDIDSLENERGALRDKLKLYAKRGGGHHAVAPPVAPTRDYSQEAPLKVAP
GVAAGEVNEALQHQLKVLSWTVERERAARITACRKAEIQTLRRLRPLEHPTAPGAVARRQ
VASQLEKELNELQTKWTLFVARSGLVQFPSEPGKYARALQIHREKQRETKQRLEERLSAL
QAEARRQLLLHRPWRCVEADLAEFPAPDLAAAIAPKTVDIGTIKFPASDQGPNDDTIYVT
PSQLSALRDLVAELQSDDIKLELTTLEPTVCAA
*(90 a.a.)

- SilkBase 1999-2023 -