SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG11035_internal:A_BomoASG_c26738_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
ribosomal_protein_S6_kinase,_90_kDa_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0001501 P skeletal system development
GO:0002224 P toll-like receptor signaling pathway
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007165 P signal transduction
GO:0007417 P central nervous system development
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019901 F protein kinase binding
GO:0030307 P positive regulation of cell growth
GO:0032496 P response to lipopolysaccharide
GO:0035556 P intracellular signal transduction
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043555 P regulation of translation in response to stress
GO:0043620 P regulation of DNA-templated transcription in response to stress
GO:0045597 P positive regulation of cell differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoASG_c26738_g1_i1
Sequence
(Amino Acid)
LLYTGKLNIIYGVFSIFRDIKPSNILFATAEKRPEDIRLVDFGLAKQLRAENGLLMTPCY
TANFVAPEVLKRAGYDAACDIWSLGVLAYIMLSGRTPFASTGDDTPDAILERIESGKVEL
STGRSEER
(41 a.a.)

- SilkBase 1999-2023 -