SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG11009_internal:A_BomoASG_c26729_g2_i2
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
serine/threonine-protein_kinase_D1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001525 P angiogenesis
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0002376 P immune system process
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004697 F protein kinase C activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006954 P inflammatory response
GO:0007030 P Golgi organization
GO:0007265 P Ras protein signal transduction
GO:0007399 P nervous system development
GO:0010595 P positive regulation of endothelial cell migration
GO:0010837 P regulation of keratinocyte proliferation
GO:0010976 P positive regulation of neuron projection development
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0030154 P cell differentiation
GO:0031647 P regulation of protein stability
GO:0032793 P positive regulation of CREB transcription factor activity
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0034599 P cellular response to oxidative stress
GO:0035556 P intracellular signal transduction
GO:0035924 P cellular response to vascular endothelial growth factor stimulus
GO:0038033 P positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway
GO:0042802 F identical protein binding
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043536 P positive regulation of blood vessel endothelial cell migration
GO:0045087 P innate immune response
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045766 P positive regulation of angiogenesis
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0048193 P Golgi vesicle transport
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051279 P regulation of release of sequestered calcium ion into cytosol
GO:0060548 P negative regulation of cell death
GO:0089700 P protein kinase D signaling
GO:1901727 P positive regulation of histone deacetylase activity
GO:2001028 P positive regulation of endothelial cell chemotaxis
RNA-seq EntryA_BomoASG_c26729_g2_i2
Sequence
(Amino Acid)
GGAGGAGSTRRPSAAAPRSPSRSSQHSHASHDDSLVVNKRSKSPSRVVWPLGQGSSLGIP
HTFEVHTYTRPTVCRHCKKLLRGLFKQGLQCRDCHYNAHRKCLPFVPKDCGGEIRDQHGE
ADSGTGSELSETAPLLDESDEEATPDHADRNSVDEEVQLRRQRDEDSDEPQRDTLPERSA
SRPSSSSSSPSANIPLMRIVQSVKHTKKREGQWLKE
(71 a.a.)

- SilkBase 1999-2023 -