SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10948_5prime_partial:A_BomoASG_c26694_g1_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		ubiquinone_biosynthesis_protein_COQ7-like_protein_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001306 P age-dependent response to oxidative stress
GO:0001701 P in utero embryonic development
GO:0001841 P neural tube formation
GO:0003682 F chromatin binding
GO:0004497 F monooxygenase activity
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0006744 P ubiquinone biosynthetic process
GO:0006979 P response to oxidative stress
GO:0008340 P determination of adult lifespan
GO:0016020 C membrane
GO:0016491 F oxidoreductase activity
GO:0022008 P neurogenesis
GO:0022904 P respiratory electron transport chain
GO:0034599 P cellular response to oxidative stress
GO:0042775 P mitochondrial ATP synthesis coupled electron transport
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0055114 P obsolete oxidation-reduction process
GO:0070584 P mitochondrion morphogenesis
GO:2000377 P regulation of reactive oxygen species metabolic process
RNA-seq EntryA_BomoASG_c26694_g1_i1
Sequence
(Amino Acid)
SPWATITTYHQINMRSPLIQHIRLAHSSSRPYWKKNPHLDQIIRVDHAGELGADRIYAGQ
MAVLGRTAEGPLIQHMWDQEKKHREKFEQLINEYRVRPTVLTPIWNVAGFVLGAGTALLG
KEAAMACTVAVETVIVDHYNDQLRTLMQDPNVDKEILETITRFRDEEQEHHDAGLQHGAE
QAPGYRALTELIKAGCRAAIQLSKKI
*(68 a.a.)

- SilkBase 1999-2023 -