SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10857_3prime_partial:A_BomoASG_c26630_g1_i1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)		frizzled-10,_partial_[Bombyx_mori]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0017147 F Wnt-protein binding
GO:0032956 P regulation of actin cytoskeleton organization
GO:0034260 P negative regulation of GTPase activity
GO:0035567 P non-canonical Wnt signaling pathway
GO:0038031 P non-canonical Wnt signaling pathway via JNK cascade
GO:0042813 F Wnt-activated receptor activity
GO:0043507 P positive regulation of JUN kinase activity
GO:0043547 P positive regulation of GTPase activity
GO:0060070 P canonical Wnt signaling pathway
RNA-seq EntryA_BomoASG_c26630_g1_i1
Sequence
(Amino Acid)
MARIVCVLLLAWLAAAEQEEAEGGKCERITLPLCQELGYNWTSMPNLMGHKDQKEAEQAM
SPFSDILGSGCSLHARFLLCSAFAPLCSEEVSGSVSACRALCETVADDCKEQIKILSPTV
MLDCSAFPLRANRKLCMRPPNASEAEPEPAPPSRWPFREHEPDRK
(54 a.a.)

- SilkBase 1999-2023 -