SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG10810_3prime_partial:A_BomoASG_c26585_g1_i2
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
protein_groucho_isoform_X5_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001106 F transcription corepressor activity
GO:0003677 F DNA binding
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007015 P actin filament organization
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007541 P sex determination, primary response to X:A ratio
GO:0008134 F transcription factor binding
GO:0016055 P Wnt signaling pathway
GO:0030154 P cell differentiation
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0043234 C protein-containing complex
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046331 P lateral inhibition
GO:0048813 P dendrite morphogenesis
GO:0070491 F DNA-binding transcription factor binding
GO:0071837 F HMG box domain binding
GO:0071906 F CRD domain binding
GO:0090090 P negative regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomoASG_c26585_g1_i2
Sequence
(Amino Acid)
MNMYPSATRHPAAAVRGPQPPAGPIKFTIADTLERIKEEFNFLQAQYHTLKLECEKLASE
KTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLSAIIGQVLPFLAQEHQQQVASAVERAKQ
QQQQHGLQQLLQQIHATAGLSHGVG
(47 a.a.)

- SilkBase 1999-2023 -