SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10800_complete:A_BomoASG_c26574_g1_i2
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		band_4.1-like_protein_5_[Bombyx_mori]
Ontology
GO:0000904 P cell morphogenesis involved in differentiation
GO:0001701 P in utero embryonic development
GO:0001756 P somitogenesis
GO:0001837 P epithelial to mesenchymal transition
GO:0001839 P neural plate morphogenesis
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0003382 P epithelial cell morphogenesis
GO:0003383 P apical constriction
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005925 C focal adhesion
GO:0006931 P substrate-dependent cell migration, cell attachment to substrate
GO:0007398 P ectoderm development
GO:0007492 P endoderm development
GO:0007498 P mesoderm development
GO:0007509 P mesoderm migration involved in gastrulation
GO:0008092 F cytoskeletal protein binding
GO:0009826 P unidimensional cell growth
GO:0010608 P posttranscriptional regulation of gene expression
GO:0010634 P positive regulation of epithelial cell migration
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0019898 C extrinsic component of membrane
GO:0019904 F protein domain specific binding
GO:0022408 P negative regulation of cell-cell adhesion
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0031032 P actomyosin structure organization
GO:0031252 C cell leading edge
GO:0032091 P negative regulation of protein binding
GO:0032092 P positive regulation of protein binding
GO:0032525 P somite rostral/caudal axis specification
GO:0032587 C ruffle membrane
GO:0048318 P axial mesoderm development
GO:0048319 P axial mesoderm morphogenesis
GO:0048339 P paraxial mesoderm development
GO:0048617 P embryonic foregut morphogenesis
GO:0051894 P positive regulation of focal adhesion assembly
GO:0070201 P regulation of establishment of protein localization
GO:0070986 P left/right axis specification
GO:0071560 P cellular response to transforming growth factor beta stimulus
RNA-seq EntryA_BomoASG_c26574_g1_i2
Sequence
(Amino Acid)
MLKFLTRGRSSSKSRNKQGQKNTNNKNLIQCKVLLLDDTDLTINLSKKASAAELYEQVFY
SLDLIEKDYFGLQFTDTNNVKHWLDPTKTIKKQIKIGPPYTLRLRVKFYSSEPNNLREEL
TRYQFFLQLKKDLLESRLQCPNTTAVELAALSLQSELGDYDDTVHTPATVLEFRFVPNQS
EEMEIEKLEEFKKYKGLTPAQAEVNYLNKAKWLEMYGVDMHIVLGKDGCEYRLGLTPTGI
LVFEAQQTIGLFFWPKITKLDFKKKKLTLIVVEDDDQGHEQEHTFVFRLHNEKACKHLWK
CAVEYHTFFRLRAPVKGPSARQNFFRMGSRFQYSGKTEYQTTQQNRARRTVQFERRPSQR
FARRQSHVLREREKQNSTKSEVNPSETNDETHNNSAETATISPASDVDALSRKSSAKSQK
SNVEPDLLDTQNDTKLSSVSDHVAEPKDSFTSINEQSKMYVRNYKH
*(154 a.a.)

- SilkBase 1999-2023 -