SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10793_3prime_partial:A_BomoASG_c26572_g2_i1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101741614_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003149 P membranous septum morphogenesis
GO:0003289 P atrial septum primum morphogenesis
GO:0003290 P atrial septum secundum morphogenesis
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0009653 P anatomical structure morphogenesis
GO:0010452 P histone H3-K36 methylation
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0032259 P methylation
GO:0034770 P histone H4-K20 methylation
GO:0042799 F histone methyltransferase activity (H4-K20 specific)
GO:0043565 F sequence-specific DNA binding
GO:0046872 F metal ion binding
GO:0048298 P positive regulation of isotype switching to IgA isotypes
GO:0060348 P bone development
GO:0070201 P regulation of establishment of protein localization
GO:2001032 P regulation of double-strand break repair via nonhomologous end joining
RNA-seq EntryA_BomoASG_c26572_g2_i1
Sequence
(Amino Acid)
MFLAERSRPFYGPADKTPKKISPEKPPRKRKPKEDHTLPLGVRPHKLKEPDLNTTYDITH
VPLKQGKCENAFKEFVRRGKEMIFDEYFYILQSNNRTDRDTLDYLLNIDASTEDKFETVQ
KNVATEKEIENYLHQCWRYNYVRKSESKEVIESTHTSPTKPQITIHISWCLVCGKKEKLR
ECPNCPSSFHMPCRREWLVNILHRKNPPQKPSKQTTLVEKILSSTRTICTVKKEKENTEL
CPSCMWGPRVGYDDVVWHKLGSCPWWPARVLTPGSTPSCLLSRSHTPHQWPLRYHDA
(98 a.a.)

- SilkBase 1999-2023 -