SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10682_3prime_partial:A_BomoASG_c26491_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_protein_son_of_sevenless_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005088 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0007015 P actin filament organization
GO:0007264 P small GTPase mediated signal transduction
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0008293 P torso signaling pathway
GO:0008360 P regulation of cell shape
GO:0008595 P anterior/posterior axis specification, embryo
GO:0016199 P axon midline choice point recognition
GO:0030154 P cell differentiation
GO:0030676 F guanyl-nucleotide exchange factor activity
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0035022 P positive regulation of Rac protein signal transduction
GO:0035023 P regulation of Rho protein signal transduction
GO:0043547 P positive regulation of GTPase activity
GO:0045500 P sevenless signaling pathway
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0046982 F protein heterodimerization activity
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_BomoASG_c26491_g1_i1
Sequence
(Amino Acid)
MLPTVEEIRGYDFLDPENVDKWRGIFVNPLKKVLEQVHPSLSAEESALEYVESLCLRLLS
TLCAAPTPRTVQDVEDRVARTFPTPLDKWAPADARDAATNKRRKIGRA
(35 a.a.)

- SilkBase 1999-2023 -