SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG10672_internal:A_BomoASG_c26481_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		polycomb_protein_suz12-B_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0001739 C sex chromatin
GO:0003682 F chromatin binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008284 P positive regulation of cell population proliferation
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016574 P histone ubiquitination
GO:0031490 F chromatin DNA binding
GO:0032993 C protein-DNA complex
GO:0035064 F methylated histone binding
GO:0035098 C ESC/E(Z) complex
GO:0042054 F histone methyltransferase activity
GO:0043565 F sequence-specific DNA binding
GO:0045596 P negative regulation of cell differentiation
GO:0045814 P negative regulation of gene expression, epigenetic
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoASG_c26481_g1_i1
Sequence
(Amino Acid)
LTLSCQRTNELGGFTNNLDKKAQKMPPKKRDKDGESNKNSKIDHLQADHELFLQAFEKPT
QIYRFLRTRNMLSPIFLNRTLSYMKRRMSRSNKSRTGFKVDSLLEKITLKKSTELQPNSL
GG
(39 a.a.)

- SilkBase 1999-2023 -