SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG10666_5prime_partial:A_BomoASG_c26475_g1_i1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
atlastin_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005874 C microtubule
GO:0007019 P microtubule depolymerization
GO:0007029 P endoplasmic reticulum organization
GO:0007030 P Golgi organization
GO:0007517 P muscle organ development
GO:0007528 P neuromuscular junction development
GO:0008152 P metabolic process
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016320 P endoplasmic reticulum membrane fusion
GO:0016787 F hydrolase activity
GO:0031114 P regulation of microtubule depolymerization
GO:0031227 C intrinsic component of endoplasmic reticulum membrane
GO:0032561 F guanyl ribonucleotide binding
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0051260 P protein homooligomerization
GO:0061025 P membrane fusion
RNA-seq EntryA_BomoASG_c26475_g1_i1
Sequence
(Amino Acid)
ALPISRPYVQPRQLEEEHHRVMNKAIHAFDSKKKMGGKELADGYKAELEKELEELFEQLR
SHNEAKNIYRMIGTPVVFATVAVLAYMLVVLGNMFGVQTVVAAGQAAVVGALVMIAVWIY
SRTTGQMRDVGAQLDEIADSIRSYILNQAFDSMRSRATAAAVGYGADKKRT
*(56 a.a.)

- SilkBase 1999-2023 -